PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00145119001
Common NameGSBRNA2T00145119001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 319aa    MW: 35148 Da    PI: 5.2274
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00145119001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.85.7e-09130179554
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                          kr++r   NR +A rs +RK  +i+eL ++v++L++e ++L  +l   + 
  GSBRNA2T00145119001 130 KRAKRILANRQSAARSKERKARYIQELVRRVQSLQTEATTLSAQLTLFQR 179
                          9****************************************998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.5E-15126190IPR004827Basic-leucine zipper domain
PfamPF077161.9E-6128175IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.289128191IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.5E-7130185No hitNo description
SuperFamilySSF579591.05E-9130181No hitNo description
CDDcd147031.13E-19131180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDKPDPPPNP NADPVPSSFH RRSRSDDMSM FMFTDPLSSA APPSSDDLPS DDDLFSSFID  60
VDSLSSNPDP PISFPDPSPA VPPSSSSRPR HRHSNSVDAG CAMYAGDEIM DAKKAMPPEK  120
LSELWSIDPK RAKRILANRQ SAARSKERKA RYIQELVRRV QSLQTEATTL SAQLTLFQRD  180
TNGLANENTE LKMRLQAMEQ QAHLRNALNE ALRKEVERMK METGEISGNS DSFDMGMQQV  240
QYSPSTFMAI PPYHHGSINN GQDMQQMRGF NQMSNSQSVS EFLQNGRLQG LEISSNNSSS  300
LVKSEGPSLS GSESSSAY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00145119001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0110015e-45AC011001.2 Arabidopsis thaliana chromosome I BAC F4H5 genomic sequence, complete sequence.
GenBankAJ4198525e-45AJ419852.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
GenBankAJ4198535e-45AJ419853.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
GenBankAY0624745e-45AY062474.1 Arabidopsis thaliana Similar to bZIP transcription factors (At1g06850; F4H5.7) mRNA, complete cds.
GenBankBT0001025e-45BT000102.1 Arabidopsis thaliana Similar to bZIP transcription factors (At1g06850) mRNA, complete cds.
GenBankCP0026845e-45CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602035.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P49e-81RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A078DBY10.0A0A078DBY1_BRANA; BnaC08g01910D protein
STRINGBra030663.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-120basic leucine-zipper 52
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]